PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G59780.1
Common NameATMYB59, ATMYB59-1, ATMYB59-2, ATMYB59-3, MTH12.19, MYB59
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 170aa    MW: 19481.6 Da    PI: 6.2653
Description myb domain protein 59
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G59780.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.27e-17243548
                     -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     T++E+ l +++++++G++ W++Iar+++ gRt++++k++w++++
      AT5G59780.1  2 TPQEERLVLELHAKWGNR-WSKIARKLP-GRTDNEIKNYWRTHM 43
                     9*****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.772147IPR017930Myb domain
SMARTSM007173.1E-12145IPR001005SANT/Myb domain
CDDcd001671.07E-12143No hitNo description
Gene3DG3DSA:1.10.10.601.2E-20244IPR009057Homeodomain-like
SuperFamilySSF466894.29E-13248IPR009057Homeodomain-like
PfamPF002493.5E-15242IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009723Biological Processresponse to ethylene
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0030154Biological Processcell differentiation
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000003anatomywhole plant
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007131developmental stageseedling development stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MTPQEERLVL ELHAKWGNRW SKIARKLPGR TDNEIKNYWR THMRKKAQEK KRPMSPTSSS  60
SNCCSSSMTT TTSQDTGGSN GKMNQECEDG YYSMDDIWRE IDQSGANVIK PVKDNYYSEQ  120
SCYLNFPPLA SPTWESSLES IWNMDADESK MSSFAIDQFP LSFEHGSGRL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.224280.0root
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453620660.0
Genevisible247696_at0.0
Expression AtlasAT5G59780-
AtGenExpressAT5G59780-
ATTED-IIAT5G59780-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Mainly expressed in leaves and seedlings, and to a lower extent, in roots, stems and inflorescences. Isoform MYB59-1 and isoform MYB59-2 are present in roots, leaves, and seedlings, while the expression of isoform MYB59-3 and isoform MYB59-4 is confined to seedlings. {ECO:0000269|PubMed:16531467}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a putative transcription factor (MYB59).
UniProtTranscription factor. {ECO:0000305}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00600PBM24477691Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G59780.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Isoform MYB59-1 is induced by jasmonate (JA), salicylic acid (SA), gibberellic acid (GA), and ethylene. Also induced by cadmium (Cd). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:16531467}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDauxin, ethylene, gibberellin, jasmonic acid, salicylic acid
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G59780
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2290480.0AK229048.1 Arabidopsis thaliana mRNA for MYB27 protein - like, complete cds, clone: RAFL16-34-F17.
GenBankAY5196410.0AY519641.1 Arabidopsis thaliana MYB transcription factor (At5g59780) mRNA, complete cds.
GenBankDQ0752520.0DQ075252.1 Arabidopsis thaliana MYB transcription factor MYB59-1 (At5g59780) mRNA, complete cds, alternatively spliced.
GenBankDQ0752530.0DQ075253.1 Arabidopsis thaliana MYB transcription factor MYB59-2 (At5g59780) mRNA, complete cds, alternatively spliced.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_851225.11e-127transcription factor MYB59
SwissprotQ4JL841e-127MYB59_ARATH; Transcription factor MYB59
TrEMBLD7MSI41e-120D7MSI4_ARALL; Putative uncharacterized protein
STRINGAT5G59780.31e-125(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Nikiforova V, et al.
    Transcriptome analysis of sulfur depletion in Arabidopsis thaliana: interlacing of biosynthetic pathways provides response specificity.
    Plant J., 2003. 33(4): p. 633-50
    [PMID:12609038]
  4. Jiao Y, et al.
    A genome-wide analysis of blue-light regulation of Arabidopsis transcription factor gene expression during seedling development.
    Plant Physiol., 2003. 133(4): p. 1480-93
    [PMID:14605227]
  5. Contento AL,Kim SJ,Bassham DC
    Transcriptome profiling of the response of Arabidopsis suspension culture cells to Suc starvation.
    Plant Physiol., 2004. 135(4): p. 2330-47
    [PMID:15310832]
  6. Stanley Kim H, et al.
    Transcriptional divergence of the duplicated oxidative stress-responsive genes in the Arabidopsis genome.
    Plant J., 2005. 41(2): p. 212-20
    [PMID:15634198]
  7. He XJ, et al.
    AtNAC2, a transcription factor downstream of ethylene and auxin signaling pathways, is involved in salt stress response and lateral root development.
    Plant J., 2005. 44(6): p. 903-16
    [PMID:16359384]
  8. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  9. Li J, et al.
    A subgroup of MYB transcription factor genes undergoes highly conserved alternative splicing in Arabidopsis and rice.
    J. Exp. Bot., 2006. 57(6): p. 1263-73
    [PMID:16531467]
  10. Cao D,Cheng H,Wu W,Soo HM,Peng J
    Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis.
    Plant Physiol., 2006. 142(2): p. 509-25
    [PMID:16920880]
  11. Lee J, et al.
    Analysis of transcription factor HY5 genomic binding sites revealed its hierarchical role in light regulation of development.
    Plant Cell, 2007. 19(3): p. 731-49
    [PMID:17337630]
  12. Libault M,Wan J,Czechowski T,Udvardi M,Stacey G
    Identification of 118 Arabidopsis transcription factor and 30 ubiquitin-ligase genes responding to chitin, a plant-defense elicitor.
    Mol. Plant Microbe Interact., 2007. 20(8): p. 900-11
    [PMID:17722694]
  13. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  14. Agudelo-Romero P, et al.
    Changes in the gene expression profile of Arabidopsis thaliana after infection with Tobacco etch virus.
    Virol. J., 2008. 5: p. 92
    [PMID:18684336]
  15. Mu RL, et al.
    An R2R3-type transcription factor gene AtMYB59 regulates root growth and cell cycle progression in Arabidopsis.
    Cell Res., 2009. 19(11): p. 1291-304
    [PMID:19581938]
  16. Cominelli E,Tonelli C
    A new role for plant R2R3-MYB transcription factors in cell cycle regulation.
    Cell Res., 2009. 19(11): p. 1231-2
    [PMID:19881525]
  17. Romero I, et al.
    More than 80R2R3-MYB regulatory genes in the genome of Arabidopsis thaliana.
    Plant J., 1998. 14(3): p. 273-84
    [PMID:9628022]
  18. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]